Is gcashivannaalawiifamilyghcghhcf.blogspot.com a scam?

Reported as a scam
This website has been flagged in the Viking Net Defense scam database.
Type: phishingTimes reported: 1First seen: 2026-09-02Last seen: 2026-09-02

What to do:

Already paid or shared info with a scam like this? You may still be protected. Build your fraud reports free at FraudFile →

Check something free →

Sussr reflects user + source reports; it's an indicator, not a legal verdict. If you believe this website was listed in error, email [email protected].

What is Sussr?

Sussr is a free scam checker from Viking Net Defense. Paste any link, email, phone number, or message and it scans 20+ scam signals — domain tricks, payment red flags, impersonation, pressure tactics, and known blocklists — then gives you a plain-language risk score in seconds. No sign-up, and nothing you paste is stored.

Check something yourself →